PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05083.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 171aa    MW: 19994.3 Da    PI: 5.6775
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05083.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1506.5e-1679137563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              +++rr+++NRe+ArrsR RK+  ++eL   v  +  eN++L ++l++l++  +k+ +e+
  Rsa1.0_05083.1_g00002.1  79 RKQRRMISNRESARRSRMRKQRHLDELWSQVMWFRVENHQLLDKLNSLSESHEKVLQEN 137
                              689***************************************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.4E-1570139IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-1177133No hitNo description
PROSITE profilePS5021710.50777140IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.43E-1379129No hitNo description
PfamPF001703.5E-1479137IPR004827Basic-leucine zipper domain
CDDcd147021.12E-1880130No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MQPQSDVFNL RNYINSSIPS PYPSHLPTSS PYPINGQNLN PFYGFQSATN IPPSMSLSSN  60
STSDEAEEQQ PDENIINERK QRRMISNRES ARRSRMRKQR HLDELWSQVM WFRVENHQLL  120
DKLNSLSESH EKVLQENIQL KEETSELKQV ISDMKIQSPF SCFRDDIIPI E
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19198RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395249.11e-106hypothetical protein EUTSA_v10005423mg
SwissprotQ9FMC21e-66BZP43_ARATH; Basic leucine zipper 43
TrEMBLV4K4U21e-106V4K4U2_EUTSA; Uncharacterized protein
STRINGBra020735.1-P1e-98(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-80basic leucine-zipper 42